SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091D273 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091D273
Domain Number 1 Region: 555-675
Classification Level Classification E-value
Superfamily PX domain 4.97e-24
Family PX domain 0.0013
Further Details:      
 
Domain Number 2 Region: 370-516
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.45e-24
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091D273
Sequence length 956
Comment (tr|A0A091D273|A0A091D273_FUKDA) Sorting nexin-13 {ECO:0000313|EMBL:KFO25102.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_13485 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
LFQASLSIWGWGSLGVVLFLITFGPFVIFYLAFYILCFVGGGLVVTLLFGKTNSEKYLEQ
CEHSFLPPTSSGVPKCLEEMKREARTIKIDRRLTGASIIDEPLQQVIQFSLRDYVQYWYY
TLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRIVDDFGTHLRVFRKAQQRITE
KDDQVKGTAEDLINTFFEVEVEMEKEVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPPGDF
QNKIMRYFVREILAHGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNVG
ELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQSGKEINTVK
LAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQQLEVLL
SRQRDGKHQTNQTKGLLRAAAFGIYEQYLSEKASPRVTVDDYLVAKLADTLNHEDPTPEI
FDDIQRKVYELMLRDERFYPSFRQNALYIRMLAELDMLKDPSFRGSDDGDGESFNGSPTG
SINLSLDDLSSVTSDDSVQLHAYISDTGVCNDHGKTYALYAITVHRRNLNTEEMWKTYRR
YSDFHDFHMRITEQFENLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLTPEMMKA
CPALAHCVYDFLENKAYSKGKGDFARKMDTFVNPLRNSMRNVSNAVKSLPDSLAEGMTKM
SDNMGKMSERLGQDIKQSFFKVPPLITKTDSDPEHCRVSAQLDDNVDDNIPLRVMLLLMD
EVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQVADSVKRFRDAF
WPNGISAETVPCRDKAIRMRTRIAGKTKLFAIMPDELKHIIGAETTRKGILRVFEMFQHN
QLNRRMVYVFLEGFLETLFPQYKFRELFNKLHSRSKQMQKYKQKLQTTQAPSLQKR
Download sequence
Identical sequences A0A091D273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]