SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091D3V1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091D3V1
Domain Number 1 Region: 1012-1140
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.49e-45
Family Regulator of G-protein signaling, RGS 0.00000573
Further Details:      
 
Domain Number 2 Region: 28-149
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.87e-21
Family Synaptotagmin-like (S variant) 0.0014
Further Details:      
 
Domain Number 3 Region: 213-293
Classification Level Classification E-value
Superfamily PDZ domain-like 7.06e-18
Family PDZ domain 0.0000238
Further Details:      
 
Domain Number 4 Region: 472-574
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000197
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091D3V1
Sequence length 1147
Comment (tr|A0A091D3V1|A0A091D3V1_FUKDA) Regulator of G-protein signaling 3 {ECO:0000313|EMBL:KFO26764.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_11867 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MERSLHRVSLGSRRAHRDLSFYLTTFGQLKLSIDARDRVLLLHIIEGKGLMSREPGVCDP
YVKISLIPESNRIRSQKTQTIPDCRDPAFHEHFFFPVPEEDDQKRLLLAVWNRASKTRRR
ALIGCMSFGVRSLLTPNKDISGWYYLLGEDMGWTKHLKVARRRLRPLRERSCQADGRSAA
PRLGGELGFHGAAAEAGPAAMNRFNGLCKVCSERRYRQITIPRGEDGFGFTICCDSPVRV
QAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPGEIILLVWRMVPQVKP
GPDGGVLRRASCKSTHDLLSPPNKREKNCTHGAQARPEQRHSCHLVCDSSDGLLLGGWER
YTEVGKCGGQHTLPALSRATAPTDPNYIILAPLNPGSQLLRPVYQEDTIPEESGSPTKGK
SYTGLGKKSRLMKTVQTVKGHGSYQDCSLLRPHVPHSSYGTYVTLAPKALVFPVFVQPLD
LCNPARTLLLTEELLLYEGRNKAAQVTLFAYSDLLLFTKEDEPGRCNVLRNPLYLQSVKL
QEGSSGDLKFCLLYLAEKAECLFTLEAHSQEQKKRVCWCLSENIAKQQQLAASPPERKMF
ETETDEKKEMPLEEGKGPGAEDSPPSKDPSPGQELPPGQDLPPIQDSSSGQEPASGQESP
ANNDSPSGQEPPLGSEAPPSEDSPSGQGSPPASDLPPCQNLAAGQEPAPCRDPALGQDLP
VVPEPLAQTSPPCQDPSPGLVSLPAEALAEETSSSGDPSAATEGLPATSRPTFVIPEVRL
DSTYSQQAGAEGGSSGDEEEAEGAEEVEEEEEDEDEDTSDDNCGERSEAKRSSMIETGLA
GEGSLSLRVQNSLRRRTHSEGSLLQEARGSCFSSDTTLHCSDGESPSPSWAIPSPRTLKK
ELGRNGGSMHHLSLFFTGHRKMSGTEVLGDDDEASQKRKTKNILSWGLKVGGPVEMLRGM
YLTRNGNLQRRHTMKEAKDVKNKLAIFRRRNESPGAPPAGKTDKMIKSFKPTSEEALKWS
ESLEKLLLHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFAEFIA
IQSCKEVNLDSYTREHTRDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQ
KKMSPPL
Download sequence
Identical sequences A0A091D3V1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]