SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091D5F2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091D5F2
Domain Number 1 Region: 141-262
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-33
Family cAMP-binding domain 0.00000043
Further Details:      
 
Domain Number 2 Region: 270-394
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.94e-32
Family cAMP-binding domain 0.000000543
Further Details:      
 
Domain Number 3 Region: 36-84
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 2.14e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091D5F2
Sequence length 403
Comment (tr|A0A091D5F2|A0A091D5F2_FUKDA) cAMP-dependent protein kinase type I-alpha regulatory subunit {ECO:0000313|EMBL:KFO18106.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_20558 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MTGKWVEGGNMADAGVFGVQRTMASGSTAASEEERSLRECELYVQKHNIQALLKDSIVQL
CTARPERPMAFLREYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRG
AISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSF
IAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAK
TNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFED
GQKIVVQGEPGDEFFIILEGTAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAAT
VVSRGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV
Download sequence
Identical sequences A0A091D5F2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]