SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091D6U6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091D6U6
Domain Number 1 Region: 78-156
Classification Level Classification E-value
Superfamily TNF-like 0.00000000000061
Family TNF-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091D6U6
Sequence length 268
Comment (tr|A0A091D6U6|A0A091D6U6_FUKDA) Tumor necrosis factor ligand superfamily member 8 {ECO:0000313|EMBL:KFO26777.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_11880 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MHVSPGTVASHLGGTSRSYFYFTTTTLALCLVFTVATIMVLVVQRTDSVLSPPGNSPHKG
GNCSDDLLCILERAPFKKSRAYLKVSKRLNSTRVFWNQDGILNGVRYQDGNLVIQFPGLY
FIICQLQFLVQCSNHPVDLKLELRVNTKVKREALVTVFLKVLFHECLSVIKNMVNVAAKC
HPTESRAQNTITVCPSPPCLLDLALCNLSLIPKVKVTLKSKPFESIQDIKASGTVQTTEE
DFLGCFRKWQAQWDKGVASRVGHFGENQ
Download sequence
Identical sequences A0A091D6U6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]