SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091D7H0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091D7H0
Domain Number 1 Region: 1056-1130
Classification Level Classification E-value
Superfamily Translation proteins 3.12e-18
Family Elongation factors 0.0000584
Further Details:      
 
Domain Number 2 Region: 342-392
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000102
Family TSP-1 type 1 repeat 0.0008
Further Details:      
 
Domain Number 3 Region: 913-970
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.000000023
Family Dual specificity phosphatase-like 0.0028
Further Details:      
 
Domain Number 4 Region: 980-1060
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000785
Family PLC-like (P variant) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091D7H0
Sequence length 1292
Comment (tr|A0A091D7H0|A0A091D7H0_FUKDA) Thrombospondin type-1 domain-containing protein 1 {ECO:0000313|EMBL:KFO28064.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_10545 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MKPMLKDFSNLLLVVLCDYVLGEAECLLLREPGHVALSNSTVSVDFQYFDSANGTLRNVS
VLLLDAATNQTVVTKYLLTNESQGTLEFECFYFREAGDYWFIMTRELSDNSTSVPWLEKR
VFLKVEWPVFHVDFNRTSQAAEGTFWVGLFTSQSLCPFPVDKPSMLVEVIFTNSLRETRT
SPGQPLEIRTSKRAELTQSQWVEFGCAPVGPEAYVNVVLKLLGRDSVITSTGPMDLAQRF
GYKLVMVPELTCESGVEVMVLPPPCIFVQGVITVFKEAPRRPGEETVKLAENSLPLGERR
TVFNCTLFDMGKNKYCFNFGNSRRSHFSAKEECMLIQRNIETWSLWQPWSQCSATCGDGV
RERRRVCLTSFPSRPGCPGVSSETSSCSLEECTAFQPSSPSPLPPEGPAKSNNIVTVTGI
SLCLFIIVATVLITLWRKFGRPPKCSTPARHNSIHSPSFRKNSDEENICELSEQHGSFSD
GGDGPGGSPGDTGIPLTYRGSGPVTPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLKEM
KKRGLTETTKVYHVSQSPLTDTAIDAAAGPPLDLESPEEAAAAANKFRIKSPFLDPPVVS
ASERPPSRLDFSMAQASCAVSPSQTLMRKSQLRHMASRGGSSERSHTRNSHFRRTASFHE
TKQARPFRERSMSTLTPRQVPTYSSRTRTWDQAEDRFRPPSRGTHLLPEKLEHYQGAGGT
SGPVSPVPKCYTLGQPTRKPDLADRQAGLAAGVERTEPHRARRGPSPSHRSVSRKQSSPT
CPKDGYQRVSPLSPSQFRKDRCQSFPAHPEFAFYDNTSFGLTEAEQRMLDLPGYFGSNEE
DETTSTLSVEKLQLLIDGHLFCRSKADIVSMEVTAKSSRVMNAFTDSRVSSDHDNKGAEV
VAVLVHVEQWAEGRTGTMVCAYLITCRLFLTAKESTYYFGERRTDKTISTKFQGIETPSQ
KRYVGYFEKLMTLYNRTLPPRKILIIKKFIIYSIHGVGKGDGSDLKVQIIMQQEAVFSCS
STNYMVFHDIESDRVIINIFNCPALYDEVKVKFLSSDVHKIGGISTVPMGRVGNGVLKPG
MVVTFAPVSVTTEVKSVEMHHEALSDALPGDNVGFSVRNVSVNDVRHGNFAKMTTNGSSW
FHCSGMKFLEDCPVQPLIPLYLLVGGIIGTLKVSLLLYDSTRMRQLLSKAVVIDDDDDDE
YPWRQNVHKYYIQLILSLFLFLWFILGNYWVFSVYRPDFIPPFQQPQAYCDRTLYLFAVG
VLALSHTVLVLLILGSSYVYMCSKWRFTADED
Download sequence
Identical sequences A0A091D7H0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]