SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091DEK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091DEK4
Domain Number 1 Region: 121-330
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.68e-46
Family G proteins 0.0000294
Further Details:      
 
Domain Number 2 Region: 7-118
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 2.35e-21
Family Obg GTP-binding protein N-terminal domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091DEK4
Sequence length 358
Comment (tr|A0A091DEK4|A0A091DEK4_FUKDA) GTP-binding protein 10 {ECO:0000313|EMBL:KFO21186.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_17421 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MGYPRLGGEGGKGGDVWVVAKKKMTLKQLKDKYPQKRFVAGGGTNSRISALKGSKGKDCE
IPVPVGISVTDENGKIIGELNKEEDRILVAEGGLGGKLLTNFLPLKGQKRVIHLDLKLIA
DVGLVGFPNAGKSSLLSQISHAKPEIADYAFTTIKPELGKIMYDDFKQISVADLPGLIEG
AHMNKGMGHKFLKHIERTKQLLFVVDISGFQLSSETQYRTAFETILLLTKELELYNEKLQ
MKPALLAVNKMDLPNAEDKFHELMSQLQNPKDFLRLFQKNMIPERTMEFQNIIPVSAITG
EGIEALKNCIRTSLDEHASREDEAYSKKQLLNLQVSNTVSYSVQSLKHAVTSSRKDIT
Download sequence
Identical sequences A0A091DEK4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]