SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091DFJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091DFJ8
Domain Number 1 Region: 237-448
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.72e-53
Family Reprolysin-like 0.001
Further Details:      
 
Domain Number 2 Region: 539-595
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.66e-16
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 889-948
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000131
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 4 Region: 837-891
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000589
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091DFJ8
Sequence length 949
Comment (tr|A0A091DFJ8|A0A091DFJ8_FUKDA) A disintegrin and metalloproteinase with thrombospondin motifs 1 {ECO:0000313|EMBL:KFO21566.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_16996 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MGKAERPPRSRSSQPAPWLLLLLAATPVLLTVPGALGRPAVEDEELVLPALERALGHETT
RLRLDAFGQQLHLELQPDRVFLAPGFTLQTVGRKPEPEAQRLDPTGDLAHCFYSGTVNGD
PSSAAALSLCEGVRGAFYLQGEEFFIQPAPASATERLAPSAAKEEPFGLPQFHLLRRRRR
GGGGSKCGVLDAETLPARGAEPEGEDAGAQRPLRDPALPRAGQPTGTGSVRKKRFVSSPR
YVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSVSLVVVKILVIYEEQKG
PEVTSNAAFTLRNFCSWQKQHNPPSDRDAEHYDTAILFTRQDLCGAQTCDTLGMADVGTV
CDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASLNGMTQDSHMMASMLSNLD
RSQPWSPCSAYMITSFLDNGHGECLMDKPQNSIQLPSDLPGTLYDANRQCQFTFGEESKH
CPDAASTCATLWCTGTSGGLLVCQTKHFPWADGTSCGEGKWCVNSKCVNKTDKKHFDTPV
HGSWGPWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEGKRVRYRSCNIEDCPDSNG
KTFREEQCEAHNEFSKASFGSGPAVEWTPKYAGVSPKDRCKLICQAKGIGYFFVLQPKVV
DGTPCSPDSTSVCVQGQCVKAGCDRIIDSKKKFDKCGICGGNGSTCKKISGSVTSAKPGY
HDIVTIPTGATNIEVKQRNQRGSRDNGSFLAIRAADGTYILNGDFTLSTLEQDITYKGVV
LRYSGSSAALERIRSFSPLKEPLTIQVLTVGNALRPKIKYTYFVKKKKESFNAIPTFSEW
VIEEWSECSKSCGLGWQRRLVECKDINGQPASECAKEVKPASTRPCADTPCPHWQLGDWS
PCSKTCGKGYKKRTLKCLSHDGGVLSHESCDPLKKPKHYIDFCTIAECS
Download sequence
Identical sequences A0A091DFJ8
XP_010606873.1.5607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]