SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091DR90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091DR90
Domain Number 1 Region: 38-69
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0000565
Family Myosin S1 fragment, N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091DR90
Sequence length 191
Comment (tr|A0A091DR90|A0A091DR90_FUKDA) Myosin-7 {ECO:0000313|EMBL:KFO25311.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_13257 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MPGGYNGENRVDMDPVPFLAPPDKERIEAMNKPYHIKKSCRVKDKEGFTAGEIWSEQGDR
VTVKTIDHQPASDLQQHHVTPGSIRRDKNCWASRLVGMSLELWSGKNHIYFFWLSLELRL
RMWGSLEDQIIQANPGWRPSGTPRPLRNNSSHFVVFDMLGFSTEEKISMYKLTRSIMHFG
NMKFKQKPREE
Download sequence
Identical sequences A0A091DR90

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]