SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091DVW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091DVW8
Domain Number 1 Region: 66-131
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000523
Family Fibronectin type I module 0.044
Further Details:      
 
Domain Number 2 Region: 164-207
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000157
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091DVW8
Sequence length 315
Comment (tr|A0A091DVW8|A0A091DVW8_FUKDA) Protein NOV like protein {ECO:0000313|EMBL:KFO35197.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_03332 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MINPTIICGTPHILTVDKHSSPKSPSDHNGTSHQLGNPLGPLKLGPYSQWHSDIQQSIQE
EVLEGDNCVFDGVIYRSGERFEPNCQYHCTCRDGQIGCVPRCQLDVLLPRPDCPAPRKVA
VPGECCEKWTCGPSEEGALGTLALPAYRPEATVGLKPSDSSINCIEQTTEWSACSRSCGM
GISSRVTNRNHQCDMVKQTRLCMVRPCEADPGPPPEKKGKKCLRTKKSLQAIHLQYENCT
SLLTYKPRFCGVCSDGRCCTPHDTKTVQVEFQCSPGQTIQKPVMLIGTCTCHTNCPKNNE
AFLQQLEQKTSGKEV
Download sequence
Identical sequences A0A091DVW8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]