SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091E0A4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091E0A4
Domain Number 1 Region: 114-155
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000011
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091E0A4
Sequence length 324
Comment (tr|A0A091E0A4|A0A091E0A4_FUKDA) Ropporin-1-like protein {ECO:0000313|EMBL:KFO36737.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_01859 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MKANAAASPHLLLASGGWLVSSFFLHRLFLLGLYCSCEDSGQTTSPLGQSPLVGCSRVSG
MTITVAFNTHRPCGTLCFPSDPHLVFTALGLGAFSLTAVAVPGAMPLPDTMFCAQQIHIP
PELPDILKQFTKAAIRTQPADLLQWSAGYFLALSQGDLLPIKDRVEMPMATQKTDTGLTQ
GLLKVLHKQCSHKAYVSLLDLERKWRTLCLPVEKLRALLQLDPCEDKIEWLKFLALGCSA
LGGSLNTAMKHFCEILTADPEGGPARIPFDTFSYVYRYLSRLDSDVSALDTESYLATLKD
SVSRKNGMVGLSDFFAPQRSTLKL
Download sequence
Identical sequences A0A091E0A4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]