SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091E1X8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091E1X8
Domain Number 1 Region: 69-119
Classification Level Classification E-value
Superfamily EF-hand 0.000000133
Family Calmodulin-like 0.071
Further Details:      
 
Domain Number 2 Region: 10-51
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000889
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091E1X8
Sequence length 121
Comment (tr|A0A091E1X8|A0A091E1X8_FUKDA) EF-hand calcium-binding domain-containing protein 10 {ECO:0000313|EMBL:KFO29076.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_09521 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MEAVESRELQARDYLEKHRIMELLNHLTSVLLFVRPPKPREYLISLLERLRLAKVTGVAF
PFFMDNSNIVAMFDMMDPSGKGTITFAQYKEALKNLGLCIADEVLNDDGHIITLDKFRDD
V
Download sequence
Identical sequences A0A091E1X8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]