SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091E6J2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091E6J2
Domain Number 1 Region: 1025-1105
Classification Level Classification E-value
Superfamily Moesin tail domain 1.83e-24
Family Moesin tail domain 0.0000719
Further Details:      
 
Domain Number 2 Region: 659-769
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000942
Family Regulator of G-protein signaling, RGS 0.0061
Further Details:      
 
Domain Number 3 Region: 17-129
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000053
Family Regulator of G-protein signaling, RGS 0.0069
Further Details:      
 
Domain Number 4 Region: 305-424
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000137
Family Regulator of G-protein signaling, RGS 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091E6J2
Sequence length 1105
Comment (tr|A0A091E6J2|A0A091E6J2_FUKDA) Regulator of G-protein signaling protein-like {ECO:0000313|EMBL:KFO30701.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_07941 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MMRWKKADEWLLEKCIGGVRGMWRFCSYLKGSAGEELVDFWILAEKILSIDEMDLEVRNY
YLSLLLMLKATYLQEGSRVVTLCNMNIKSLLNLCSWHPNQSTTRRETLSHMQKVALFKLQ
SYWLPNFYTHAKMAMASEGACYGLMQEYETRLCSFCYTHMGGLPLNMSIKKSLHFQNKYS
SKKAKRKIWQLTDHTSWSLELDLMPDISTSQEASSQEKMVIQMPSLEVPSSKERTISSLE
KDSHCVKKSSVKKKYKCHVHMEDLFETKFSTHLRTSTSIIHHPSRIIIKKAINQSFSLVY
THWALCADACAGCPFRDYLKKLNLKVETQLLDLWQDLQHFLRVLMNNKKSGKALFLRLLG
DRICELYLNEKIGLRLPLKSQIIQGLKDMLPSGDVNPWIPKAQKEICKMLSPWYDKFLDE
EDYWFLIFTTQTRFIKSRWHRKESTDKKDNILLYKRVQESLKLSQALANMEEMESMEWQK
IATKDLRQGGSLQVELTSPVFLEGLQNPLGCIRAVHNVLLRVFIRLLPSMLDSTKVQSLV
DRIPDDPDNIPPIDVLRIKRAQGDINKMPFEELCYKNPKVAVEKISEDYKIYCEKAPKAG
SWLWLMVFQNLDEAFMPVQLFYVDTTVEMIKEQKIIATSNRKISLFKKVGLQKPSVRPRN
LAEVLLNTQHLQFFREFLRHRKAENPLLFLIAVQKISMETNEKIYKSTLENIIKTYLHGK
HPPEEMLQCNAPIIKKVPHMHHIGATTLLILQSYVMKSLEEKWFKEYQELFPLPPLEVET
EVQTSQRKPSKTTVNLQESQKRGWLKMVNFIKSFCSYRRFISNPRKCQEFIEYLHLEMHN
KENFSTSPTVSGRLTPLSTNARRTEQEKEEISLVKRRIYGQRIIVINFAVNDLYFLSEME
KFNDLVSSAQMLQSNRAYNENDVVLMQSKINIILRLFLHAEFSPKLRVNITESQKDAILT
SIAEGHLDRNMFHGAIMSVFPVIMYFWKRFCAWKATHNYLHYVGKNFKDRKILPKLTNKN
PPGSSGVMNHRSDEDHVIETQKNERVKKKLQALNSELAQARDETKKKQSDVFHADNVKAG
HDKYKTLRQIQQGNTKQRIDESEAM
Download sequence
Identical sequences A0A091E6J2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]