SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091E6R6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091E6R6
Domain Number 1 Region: 122-161
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000249
Family TSP-1 type 1 repeat 0.00077
Further Details:      
 
Domain Number 2 Region: 534-583
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000445
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 3 Region: 478-528
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091E6R6
Sequence length 630
Comment (tr|A0A091E6R6|A0A091E6R6_FUKDA) A disintegrin and metalloproteinase with thrombospondin motifs 16 {ECO:0000313|EMBL:KFO38468.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_00117 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MCASPCGPGEVPALRVLLRPQLCPRIPVLPLLLCGPSWSRSLCCQRFLLDKDVQKTSAQV
SELPLVLVLSLHTQDICKALWCHRVGRKCETKFMPAAEGTLCGQDMWCRGGQCVKYGDEG
PEPTHGQWSDWSPWSPCSRTCGGGVSHRDRLCSNPNQKCPKDSVDFRTAQCAEYNSKQFR
GWHYKWKPYTRVEDQDLCKLYCIAEGFDFFFSLSNKVKDGTPCSEDSRNVCIDGICERVG
CDNILGSDAAEDSCGVCKGNNSNCMTHRGVYNKHHHTNQYYHMITIPSGARSIHIYETNI
STSYISVRNILKRYYLNGHWTVDWPGWYKFSGASFDYRRSYKEPESLTSAGPTNETLIVE
LLFQGRNPGVAWEFSLPRSGAEKKPPVQPRYTWAIMRSECSVSCGGGHLITKGGCYRDMS
LQVNTSFCNPKTRPATALVSCGVSACPPRRSTKLSLVQGCLPPSSDAIFGSVTCVLRECS
RTCGKGWRKRAVACKNTDPSARVQLLPNAMCVAEPKPRTHEACLLPRCHQHKKRQWLVSA
WSQCTASCGGGVQMRTVQCLAGTQPASDCPLHQKPEASLACNTHFCPIEEKKGTFCRDAF
HWCSLVPQHGRCSHRFYGKQCCRACSRSNL
Download sequence
Identical sequences A0A091E6R6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]