SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091E783 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091E783
Domain Number 1 Region: 935-1102
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-81
Family Thrombospondin C-terminal domain 0.0000000586
Further Details:      
 
Domain Number 2 Region: 4-205
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.61e-38
Family Laminin G-like module 0.000011
Further Details:      
 
Domain Number 3 Region: 812-934
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.71e-37
Family TSP type-3 repeat 0.000000563
Further Details:      
 
Domain Number 4 Region: 744-814
Classification Level Classification E-value
Superfamily TSP type-3 repeat 5.62e-17
Family TSP type-3 repeat 0.00026
Further Details:      
 
Domain Number 5 Region: 471-522
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.31e-16
Family TSP-1 type 1 repeat 0.0001
Further Details:      
 
Domain Number 6 Region: 415-464
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000523
Family TSP-1 type 1 repeat 0.0001
Further Details:      
 
Domain Number 7 Region: 670-755
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000157
Family TSP type-3 repeat 0.0001
Further Details:      
 
Domain Number 8 Region: 295-353
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000209
Family VWC domain 0.0024
Further Details:      
 
Domain Number 9 Region: 360-403
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000103
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 10 Region: 527-580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000766
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091E783
Sequence length 1102
Comment (tr|A0A091E783|A0A091E783_CORBR) Thrombospondin-2 {ECO:0000313|EMBL:KFO53943.1} KW=Complete proteome; Reference proteome OX=85066 OS=Corvus brachyrhynchos (American crow). GN=N302_14524 OC=Corvus.
Sequence
EEETTFDLLQVSSINRKTIGAKVFRGPDPTMPAYRFIRFDHIPPCKPEKLKKIIKLIRQN
EGFILSATLRQDRQSRGTILALEGPGISERQFEIISNGRANTLDLIYWVDGFQNVISLED
VDLADSQWKNLTVQITGENYNLYVGCDLIDSFILEEPFYEQLKAESSRLYLAKGSTRENH
FRGLLQNIQLIFGTSIEDVLRKKGCQRSQSTEVNTINESTEILHLSPAVTTEYVGEKPEK
AEFCDRSCEELGSMFTELTGLRIVVNNLADNLQKVSEENQIMWELIGPNKTLKSQPVCWQ
DGRVFADNESWIVDSCTKCVCQDSKIVCNQITCPAVSCADPAFVEGECCPVCSHSDDSEE
GWSPWSDWTKCSVTCGSGTQMRGRSCDVTRSACTGPHIQTRMCSFKKCDHRIRQDGGWSH
WSPWSSCSVTCGVGNITRIRLCNSPIPQMGGKNCVGNGRETEKCEKAPCPVNGQWGPWSP
WSACTVTCGGGIRERSRLCNSPEPQYGGKPCVGDTKQHDMCNKKDCPIDGCLSNPCFPGA
ECNSYPDGSWSCGACPAGYLGNGTVCEDLDECIAVSDVCFKVNQVHRCVNTNPGFHCLPC
PPRYKGSQPYGVGLEVAKTEKQVCEPENPCKDKTHSCHKSADCIYLGHFSDPMYKCECRT
GYAGDGRICGEDSDLDGWPNNNLVCAANATYHCVKDNCPLLPNSGQEDFDKDGKGDACDE
DDDNDGVEDDKDNCPLLFNPRQFDYDKDEVGDRCDNCPYVHNPAQIDTDNNGEGDSCAVD
IDGDDIFNERDNCPYVYNTDQSDTDGDGVGDQCDNCPLMHNPDQTDADNDLVGDQCDNNE
DIDEDGHQNNQDNCPYIPNANQADHDQDGKGDACDSDDDNDGVPDDRDNCRLRYNPEQED
SDGDGRGDICKDDFDNDNVPDIYDVCPENNAISETDFRKFQMVPLDPKGTAQIDPNWVIR
HQGKELVQTANSDPGIAVGYDEFSSVDFSGTFYVNTDRDDDYAGFVFGYQSSSRFYVLMW
KQVTQTYWEDKPTRAYGYSGVSLKVVNSTTGTGEHLRNALWHTGNTPGQVRTLWHDPKNI
GWKDYTAYRWHLIHRPKTGLIK
Download sequence
Identical sequences A0A091E783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]