SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091E9H2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091E9H2
Domain Number 1 Region: 820-898
Classification Level Classification E-value
Superfamily DEATH domain 1.61e-18
Family DEATH domain, DD 0.0000651
Further Details:      
 
Domain Number 2 Region: 127-218
Classification Level Classification E-value
Superfamily Immunoglobulin 5.37e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 217-267
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000902
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 4 Region: 271-325
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.00081
Further Details:      
 
Domain Number 5 Region: 20-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000012
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091E9H2
Sequence length 922
Comment (tr|A0A091E9H2|A0A091E9H2_CORBR) Netrin receptor UNC5D {ECO:0000313|EMBL:KFO53099.1} KW=Complete proteome; Reference proteome OX=85066 OS=Corvus brachyrhynchos (American crow). GN=N302_03435 OC=Corvus.
Sequence
GNENSESLPESIPSAPGTLPHFLEEPDDSYIIKSNPIVLRCRAVPAMQIFFKCNGEWVHQ
NEHVSHESLDEATGLKVREVSINVTRQQVEDFHGPEDYWCQCVAWSHLGTSKSRKASVRI
AYLRKNFEQDPQGKEVPIEGMIVLHCRPPEGVPAAEVEWLKNEEPIDSNLDENIDTRADH
NLIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVYVNGGWSSWTEWSSCNARCGRGWQK
RSRTCTNPAPLNGGAFCEGMSVQKITCTSLCPVDGNWEVWSEWSVCSPECEHLRVRECAA
PAPRNGGKHCEGLSQESENCTEGLCIQDKKSLHEIKSQKSRPEKSPPWLLCARLGAGSSF
LMELCSMGVIQGILSHSGEYGVDVIDSSALTGGFQTFNFKTVRQGNSLLLNSSLQPDLTV
SRTYSGPICLQDPLDKELMTESSLFNPLADIKVKVQSSFMVSLGVTERAEYQGKAHPGTF
PHGNHRAFGTIQARNKAMYIQNLASISTSSELRTTALFGHLGGRLVVPNTGVSLLIPHGA
IPEESSWEIYLAITQKESSLEPEGPEVLLGPEVSCGPPELSVSTPFALTIPHCAHADPQH
WNIHLKRRTQQGKWEEVMSVEEETTSCYCLLDPYACHILLNSFGTYALIGEPISDCAVRQ
LKVAVFGCLSCNSLDYNLRVYCMDNTPCAFQEVVSDERLQGGQLLEEPKLLHFKGNTCSL
QISVLDVPPFLWRIKPFTACQEVPFSRVWRGSPRPLLGAFSLERFSPATTQLCCKVCVRQ
LQGHEQLLHIQTSVLETERENITFFAHEDSNFPAQLGPKAFKIPHSIRQRICATFDAPSA
KGKDWQMLAQKNSINRNLSFFATQSSPSAVILDLWEARHQHDGDLDSLACALEEIGRTHS
KVSDVAEPELEEPEFPSSRNGL
Download sequence
Identical sequences A0A091E9H2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]