SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091EEL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091EEL3
Domain Number 1 Region: 19-151
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.22e-36
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 324-411
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-26
Family Ras-binding domain, RBD 0.00021
Further Details:      
 
Domain Number 3 Region: 268-337
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.96e-19
Family Ras-binding domain, RBD 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091EEL3
Sequence length 504
Comment (tr|A0A091EEL3|A0A091EEL3_CORBR) Regulator of G-protein signaling 14 {ECO:0000313|EMBL:KFO55556.1} KW=Complete proteome; Reference proteome OX=85066 OS=Corvus brachyrhynchos (American crow). GN=N302_05339 OC=Corvus.
Sequence
RGSNHSVNSLPGPPTSCGSTQGSVVSWAESFETLLQDRVAVTYFTEFLKKEFSAENVYFW
QACERFQQIPASDTQQLAQEARRIYDEFLSSHSVSPVNIDKQAWIGEDMLATPSPDMFRI
QQLQIFNLMKFDSYTRFVKSPLYQACLRAESQGQPLPDLRPHSRSSSPPPDLSKKSKLKL
GKSLPLGVETAGSGANRSPRRSFRKGERREPSWAGGRSAMLWRESQGSLNSSASLDLGFL
SSASTATSPCTEKSLGGSEAELPAKPMKYCCVYLPDGTASLASVRPGRSIRDMLAGICEK
RGFSLPDIKVYLVGNEQKALVLDQECSVLADQEVKLENRISFDLEISSLNKTIRITARST
KRIREALQPVLGKYGVSVEQALLRRQGEPATLDLEKLVSTVSAQKLVLETPAAAAVVHRE
AGPCCLGCSLQEGSPTGAEPDTRWEVPSSFSRPRASAAMNLNRRTYDLEGLVELLTRAQS
CRANDQRGLLSKEDLVLPDFLQLP
Download sequence
Identical sequences A0A091EEL3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]