SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091EFL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091EFL9
Domain Number 1 Region: 2-136
Classification Level Classification E-value
Superfamily YWTD domain 5.89e-22
Family YWTD domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091EFL9
Sequence length 185
Comment (tr|A0A091EFL9|A0A091EFL9_CORBR) Low-density lipoprotein receptor-related protein 1 {ECO:0000313|EMBL:KFO55911.1} KW=Complete proteome; Reference proteome OX=85066 OS=Corvus brachyrhynchos (American crow). GN=N302_04738 OC=Corvus.
Sequence
KVFFTDYGQIPKVERCDMDGQNRTKLVDSKIVFPHGITLDLVNRLVYWADAYLDYIEVVD
YEGKNRHTIIQGILIEHLYGLTVFENYLYATNSDNANAQQKTSVIRVNRFNSTEYQVVTR
VDKGGALHIYHQRRQPTVRSHACEPDQFGKPGGCSDICLLGNSHKSRTCRCRSGFSLGSD
GKSCK
Download sequence
Identical sequences A0A091EFL9 A0A091JWN9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]