SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091EST8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091EST8
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily TIMP-like 1.96e-63
Family Tissue inhibitor of metalloproteinases, TIMP 0.0000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091EST8
Sequence length 178
Comment (tr|A0A091EST8|A0A091EST8_CORBR) Metalloproteinase inhibitor 4 {ECO:0000313|EMBL:KFO60938.1} KW=Complete proteome; Reference proteome OX=85066 OS=Corvus brachyrhynchos (American crow). GN=N302_07206 OC=Corvus.
Sequence
VIRAKISSEKVVPASDDPLDTHKMIRYEIKQIKMFKGFEKLKDVQYVYTPFDSSLCGVKL
EANNKKQYLLTGQILSDGKVLIHLCNYIEPWDDLSLSQKKSLNQRYQMGCGCKITTCYMV
PCSITAPNECLWTDWLIERKLYGHQAKHYACIKRSDGTCSWYRGGPPPEKEFIDISEP
Download sequence
Identical sequences A0A091EST8 A0A091MF24 A0A091SZ08 A0A091TUB3 A0A093I2B6 A0A093I8E2 A0A093Q825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]