SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091EW05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091EW05
Domain Number 1 Region: 264-467
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.82e-53
Family Reprolysin-like 0.0003
Further Details:      
 
Domain Number 2 Region: 557-614
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000116
Family TSP-1 type 1 repeat 0.0002
Further Details:      
 
Domain Number 3 Region: 1099-1151
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000981
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 905-962
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000249
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 963-1022
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000392
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 6 Region: 1027-1089
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000392
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 7 Region: 848-902
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000209
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091EW05
Sequence length 1195
Comment (tr|A0A091EW05|A0A091EW05_CORBR) A disintegrin and metalloproteinase with thrombospondin motifs 18 {ECO:0000313|EMBL:KFO60494.1} KW=Complete proteome; Reference proteome OX=85066 OS=Corvus brachyrhynchos (American crow). GN=N302_14078 OC=Corvus.
Sequence
LQTLQLCCLCCMSHAATLTSDSISELTHDYVFVTPVRVDASGSYISHDVLHSSRRKRSTQ
SSKSSLHYKFSAFGQELHLELKPSTILSKSFIVQVLGKDGVSNSQEHEIEQCFYQGFIRN
DSTSSVAISTCVGLSGLIRTRQIEFLISPLPQQLAQEHNFTSPAGHHPHVLYKRTAEGKV
HRYPVEPHPKSSPFGHDRMHTSHKFHAQASGYHHGRFQKQHFCGRRKKYAPKPPTEETYI
RSDEYGTSVRFKRSSAKIQKNGSLNVETLVVADKKMLEKHGKENVTTYILTVMNMVSSLF
KDGTIGSDINIIVVSLLLLEQEPSGLLINHHADQSLNSFCQWQSALVGKNGKRHDHAILL
TGFDICSWKNEPCDTLGFAPISGMCSKYRSCTINEDTGLGLAFTIAHESGHNFGMIHDGE
GNACRKAEGNIMSPTLTGNNGVFSWSVCSRQYLNKFLSTAQAACLIDEPKQTGQYKYPDK
LPGQIYDADTQCKWQFGMKAKLCNLSFVKDICKSLWCHKVGHRCETKFMPAAEGTACGIS
MWCRRGQCVRYGDHGPKPVNGQWSAWSEWSECTRTCGGGVTYQERHCNNPKPQYGGKFCQ
GSSRVYQLCNKQPCPADSLDFRAQQCAEYNSKPFRGWFYKWKPYTKVEEEDRCKLYCTAE
DFDFFFAMSSKVKDGTLCSPNNYDICIDGICEQVGCDHGLGSKAVLDACGVCKGDNSTCK
FFKGQYLIQHKANDYYAVVTVPAGARSIQLQEMHVSSSYLAVRSLANKYYLTGDWTIDWP
GKFPFAGTVFDYQRSFNHPESLYAAGPTNETLVFEILLQGKNPGIAWEYTFAKTSIEDKT
SARKHSYSWVTVQSECSATCGGGHITAKAICLEDHRARVNTSFCGPRTKPLTETKLCNTN
PCPAYWSAGEWSTCSKSCGGGQQSRLVQCVQKRAFQREEVVAHSLCPVSTPAQVQVCSSQ
DCPPEWSPGPWSQCSKTCGRGSKKRDVYCKSTGSPEVKILPESMCSTEPKPESQQTCVLG
RCPKNDRLQWVISSWSECSASCGPGLRRRELKCGEKSIHGKLLTFPQRRCRNIKKPNTNL
EEACNKGACLSQTLYNMVSGWYSSPWQQCTVTCGGGVQTRSVQCLLQGRPAAGCLPQQKP
AVLRACNTNFCPVPVKRDDPSCVDFFTWCHLVPQHGVCNHKFYGKQCCKSCTKKN
Download sequence
Identical sequences A0A091EW05

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]