SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091EW14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091EW14
Domain Number 1 Region: 13-82
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000267
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 2 Region: 175-220
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000235
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 3 Region: 83-148
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000806
Family Fibronectin type I module 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091EW14
Sequence length 328
Comment (tr|A0A091EW14|A0A091EW14_CORBR) WNT1-inducible-signaling pathway protein 1 {ECO:0000313|EMBL:KFO62058.1} KW=Complete proteome; Reference proteome OX=85066 OS=Corvus brachyrhynchos (American crow). GN=N302_04554 OC=Corvus.
Sequence
TTETYTRTQYCKWPCECPKSPPRCAVGISLVTDGCDCCKTCAKQRGESCTEADTCDFHRG
LYCDYSGDRPRYEIGVCAQIVGVGCVLNGVRYKNGETFQPNCKYNCTCINGAVGCVPMCT
NSRPPLVWCPNPKLIKMAGKCCEQWICDDSRKIRKTSPRHISSAAYEGEDEAWQKNCIVH
TSPWSPCSKTCGLGISTRISNDNDQCRLLKESRLCNMRPCEVDITQHIKPGKKCLAVYRA
NEPMNYTISGCVSKSPYRPKYCGVCTDNRCCTPYKSKTIEVRFQCPDGIEFSWKIMWINA
CFCNLNCRNPNDIFADLAHYHDYSEIAN
Download sequence
Identical sequences A0A091EW14

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]