SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091F4B0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091F4B0
Domain Number 1 Region: 932-1099
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-81
Family Thrombospondin C-terminal domain 0.0000000198
Further Details:      
 
Domain Number 2 Region: 11-220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-40
Family Laminin G-like module 0.0000000635
Further Details:      
 
Domain Number 3 Region: 809-930
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.18e-36
Family TSP type-3 repeat 0.000000201
Further Details:      
 
Domain Number 4 Region: 729-811
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.48e-16
Family TSP type-3 repeat 0.0000893
Further Details:      
 
Domain Number 5 Region: 475-533
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.92e-16
Family TSP-1 type 1 repeat 0.0000358
Further Details:      
 
Domain Number 6 Region: 422-471
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 8.24e-16
Family TSP-1 type 1 repeat 0.0000501
Further Details:      
 
Domain Number 7 Region: 303-361
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000115
Family VWC domain 0.0044
Further Details:      
 
Domain Number 8 Region: 365-415
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000051
Family TSP-1 type 1 repeat 0.00065
Further Details:      
 
Domain Number 9 Region: 534-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000144
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091F4B0
Sequence length 1099
Comment (tr|A0A091F4B0|A0A091F4B0_CORBR) Thrombospondin-1 {ECO:0000313|EMBL:KFO63667.1} KW=Complete proteome; Reference proteome OX=85066 OS=Corvus brachyrhynchos (American crow). GN=N302_01699 OC=Corvus.
Sequence
LSAESRSDDNSVFDLFELIGFMRKGAGRRAPGVYLVKGPESSSPAYRIEDASRIPAVPDS
KFQDLLDAIHAEKGFILLATLRQAKKSRGTLLSVEQKDGSGHVFSLVSNGKAGSLDLSLS
GDGKQQLVSVEDVLLATGHWKNITLFVQEDRAQLYVGCEKMENAELDIPIQNIFTRDLAS
SARLRIAKGGVNDNFQGLLQNVRFVFGTTLETILRNKGCSSSTSAIITLDNPINGSSPAI
RTNYIGHKTKDIQAVCGFSCDELTNMFVELQGLRSMVTTLQDRVRKVTEENEIIAKVVQI
TPGACIHNGILHKNKEEWTIDSCTECTCQNSATICRKVSCPLMPCSNATVPDGECCPRCW
PSDYADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSVQTRTCHLQECDKRFK
QDGGWSHWSPWSSCSVTCGTGIITRIRLCNSPVPQLNGKPCEGEARENKACQKDPCPING
NWGPWSPWDACTVTCGGGLQKRSRLCNNPEPQYGGKTCVGEARGTQVCNKQDCPIDGCLS
NPCFAGATCTSAPDGSWKCGACPAGYHGDGIHCQDIDECKEVPDACFVFNGVHRCENTEP
GYNCLPCPPRFTGTQPFGRSVEDAMSNKQVCKPRNPCTDGTHDCNKNAKCNYLGHFSDPM
YRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPNLPNSGQEDYDVRK
QKRLAFEYDNCPFIYNPQQYDYDRDDVGDRCDNCPYNHNPDQTDTDNNGEGDACAIDIDG
DGVLNERDNCQYVYNVDQRDTDLDGVGDQCDNCPLEHNPDQEDSDSDRIGDQCDNNQDID
EDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDKDNCRLVANPDQADSDG
DGRGDACKDDFDQDSVPDIDDICPENVEISETDFRRFQMIPLDPKGTSQNDPNWVVRHQG
KELVQTVNCDPGLAVGFDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQI
TQSYWDSTPTKAQGYSGLSIKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWK
DFTAYRWRLSHRPKTGYIR
Download sequence
Identical sequences A0A091F4B0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]