SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091FCX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091FCX8
Domain Number 1 Region: 4-105
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.83e-22
Family N-utilization substance G protein NusG, N-terminal domain 0.0051
Further Details:      
 
Domain Number 2 Region: 114-165
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000421
Family N-utilization substance G protein NusG, C-terminal domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091FCX8
Sequence length 167
Comment (tr|A0A091FCX8|A0A091FCX8_9DELT) Uncharacterized protein {ECO:0000313|EMBL:KFO66597.1} KW=Complete proteome; Reference proteome OX=1499107 OS=Smithella sp. SCADC. GN=ER57_16380 OC=Syntrophaceae; Smithella.
Sequence
MSTAKWYALYVKSRHEFIVSNELQRKGIITFLPSVTKLNHWTDRKKHVECPLFPGYLFVY
IAPSPEEFSKVIKTRGAVTFVSMNPGFPAAVREEEISSLKIMLESGVEIDIYPHLKEGVP
VRLRSGVFQGAEGILEKKNNQHIFIVSIKVLGRSVGVKMHADTVEAA
Download sequence
Identical sequences A0A091FCX8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]