SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091FJN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091FJN2
Domain Number 1 Region: 3-380
Classification Level Classification E-value
Superfamily Sema domain 3.01e-123
Family Sema domain 0.000000245
Further Details:      
 
Domain Number 2 Region: 727-785
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 4.19e-17
Family TSP-1 type 1 repeat 0.0002
Further Details:      
 
Domain Number 3 Region: 673-724
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 5.89e-16
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 4 Region: 485-535
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000419
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 5 Region: 376-428
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000349
Family Plexin repeat 0.0047
Further Details:      
 
Domain Number 6 Region: 540-591
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000471
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 7 Region: 786-831
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000602
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 8 Region: 429-482
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000484
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091FJN2
Sequence length 964
Comment (tr|A0A091FJN2|A0A091FJN2_9AVES) Semaphorin-5A {ECO:0000313|EMBL:KFO70720.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_00079 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
QEECQNYIRVLLVGGNHLFTCGTNAFTPICTNRTLSNLTEIHDQINGMARCPYSPQHNST
ALLTSSGELYAATAMDFPGRDPAIYRSLGALPPLRTAQYNSKWLNEPNFVSSYDIGNFTY
FFFRENAVEHDCGKTVFSRAARVCKNDIGGKFVLEDTWTTFMKARLNCSRPGEIPFYYNE
LQSTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAITQAFNGPFKYQENSRSAWLPYPN
PNPNFQCGTMDQGLYVNLTERNLQDAQKFFLMHEVVQPVIPIPYFMEDNSRFSHVVVDVV
QGKDMLFHIIYLATDYGTIKKVLAPMNQTSSSCLLEEIELLPKSQREPIRSLQILHSQSV
LFVGLQEHVIKVPLKRCPFYKTYSACIGSQDPYCGWDMVMKKCTTLEESLSMSQWEQSIT
VCPMRNLTVDGHFGTWSQWKPCTHTDGASVGSCLCRTRVCDSPAPQCGGWLCEGPTMEIA
NCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLC
PPHVFWTGWGPWERCTAQCGGGIQARRRTCENGPDCPGCSVEYQPCNTNACPELKKTTPW
TPWTPVNISDNGGHYEQRFRYTCKARLPDPNLLEVGRQRIEMRYCSSDGTSGCSTDGISG
DFLRSGRYSAHTINGAWSPWSPWSQCSRDCSRGIRNRKRVCSNPEPKYGGLPCLGPSLEY
QECNILPCPVDGGWSCWSSWSKCSATCGGGHYMRTRSCTNPAPAYGGDICLGLHTEEALC
NTQPCPDSWSEWSEWSDCDSSGFQFRVRQCIILFPVGSQCTGNTTESRACALDSNFIPEI
SVARSSSIEEKRCGEFNMFHMIAVGLSSSILGCLLTLLVYTYCQRYQQQSHDATVIHPVS
PAPLNTSITNHINKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTAKTYSNTYFTDFNN
YDEY
Download sequence
Identical sequences A0A091FJN2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]