SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091FLW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091FLW1
Domain Number 1 Region: 15-81
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000753
Family Growth factor receptor domain 0.0036
Further Details:      
 
Domain Number 2 Region: 172-216
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000392
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 3 Region: 78-122
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000105
Family VWC domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091FLW1
Sequence length 315
Comment (tr|A0A091FLW1|A0A091FLW1_CORBR) WNT1-inducible-signaling pathway protein 3 {ECO:0000313|EMBL:KFO62320.1} KW=Complete proteome; Reference proteome OX=85066 OS=Corvus brachyrhynchos (American crow). GN=N302_02779 OC=Corvus.
Sequence
PSETGEVQRKEVCHWPCRCPPVPACTPGVSLVKDGCGCCKVCAKQAGEPCNEADVCDPHK
GLYCDYSEDKPRYETGVCAYLVAVGCELNGVYYANGQTFQPNPLYKCLCVSGTIGCTPVF
TPRLAGSPCARVTGRKKPGQSICSLGQHKQLQSTNYRLMSAYRSLPLVLKKKCLIQATPW
TPCSRTCGIGISSRVTNDNRKCEMKKEKRLCFIQPCLTNMLKKIKIPKGKTCQPTFQLPT
AEKLFFSGCSTTQRYKLTFCGACLDKRCCVPNKSKMITVQFECPNEGFFRWKMMWITSCV
CQRTCSAPEDIFSQL
Download sequence
Identical sequences A0A091FLW1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]