SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091FLY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091FLY0
Domain Number 1 Region: 47-104
Classification Level Classification E-value
Superfamily RING/U-box 7.53e-18
Family ZZ domain 0.009
Further Details:      
 
Domain Number 2 Region: 340-388
Classification Level Classification E-value
Superfamily UBA-like 3.57e-16
Family UBA domain 0.00018
Further Details:      
 
Domain Number 3 Region: 1-33
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000299
Family PB1 domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091FLY0
Sequence length 393
Comment (tr|A0A091FLY0|A0A091FLY0_9AVES) Sequestosome-1 {ECO:0000313|EMBL:KFO69941.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_03205 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
DEDGDLIAFSTDEELEMAMPYVRDGVFRVYIKEKKECKREHRSQCSQEPSRDMVHPNVIC
DGCEGPVVGSRFKCTVCPDYDLCSTCEGKGIHKEHNMVMFQSPLLNPFEWIPRGRWLRKR
RHGVPPFPWMHCWGYPGPAAPCQNSEQAQASAAASSPPAAEEASTNSQPQDPNVTFLKNV
GESVAAFLSPLGIEVDIDVEHGGQRSKVTPASPTRENSAESGSSAVNQNLQTKPDQNTTA
SAREVNAVAEQIQDMVIDPVPTQMEDGSFQSQEHSESSSSSGVDEDWTHLSSKEVDPSTG
ELQSLQMPETEGPSSLDVSQDPPQPGPTGLREAALYPHLPPEADPRLIESLSQMLSMGFS
DEGGWLTRLLQTKNCDIGAALDAIQYSKQPPHL
Download sequence
Identical sequences A0A091FLY0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]