SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091FM91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091FM91
Domain Number 1 Region: 5-60
Classification Level Classification E-value
Superfamily TNF-like 0.0000000000000018
Family TNF-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091FM91
Sequence length 60
Comment (tr|A0A091FM91|A0A091FM91_9AVES) Complement C1q-like 2 {ECO:0000313|EMBL:KFO71605.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_07867 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
QVRASAIAQDADQNYDYASNSVVLHLDSGDEVYVKLDGGKAHGGNNNKYSTFSGFLLYPD
Download sequence
Identical sequences A0A087QNM7 A0A091F1E6 A0A091FM91 A0A091GSD9 A0A091K1G0 A0A091ULV4 A0A091VFY1 A0A093GU59 A0A093INI8 G1NRX4 K7F0M8
ENSMGAP00000016884 ENSGALP00000014176 28377.ENSACAP00000006256 9031.ENSGALP00000014176 ENSPSIP00000001588 ENSPSIP00000001588 ENSMGAP00000016884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]