SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091FMM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091FMM1
Domain Number 1 Region: 53-501
Classification Level Classification E-value
Superfamily Sema domain 6.93e-143
Family Sema domain 0.0000000633
Further Details:      
 
Domain Number 2 Region: 794-846
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 9.42e-16
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 
Domain Number 3 Region: 606-656
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000497
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 4 Region: 848-906
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000112
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 5 Region: 497-547
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000593
Family Plexin repeat 0.004
Further Details:      
 
Domain Number 6 Region: 660-712
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000759
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 7 Region: 906-952
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000209
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091FMM1
Sequence length 1092
Comment (tr|A0A091FMM1|A0A091FMM1_9AVES) Semaphorin-5B {ECO:0000313|EMBL:KFO70848.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_12770 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
MVVSRLKAISLSLPSLFLLAFHLSATQNVPEYSEAEHQQCVRKEHPTIAFEDLKPWVSNF
TYPGVHDFSQLALDANRNQLIVGARNYLFRLSLHNVSLIQATSWGSDEDTRRSCQSKGKT
EEECQNYVRVLIVYGKKVFTCGTNAFSPVCSSRQVGNLSKIIDRINGVARCPHDPRHNST
AVITSRGELYAATVIDFSGRDPAIYRSLGNVPPLRTAQYNSKWLNEPNFIAAYDIGLFTY
FFFRENAVEHDCGKTVYSRVARVCKNDIGGRFLLEDTWTTFMKARLNCSRAGEIPFYYNE
LQSTFYLPEQDLIYGVFTTNVNSIAASAVCAFNLSAITQAFNGPFRYQENPRSAWLPTLN
PIPNFQCGTLNDDSPNENLTERVLQDAQRLFLMNDVVQPVTVDPYVTQDSIRFSKLVVDI
VQGKDTLYHVMYIGTEYGTILKALSTTNRSLRSCYLEEMQILPDGQQEAIKSLQILHSDR
SLFVGLNNGVLKIPLERCSMYRTEGECLGARDPYCGWDNKQKRCTTIEDSSNMSLWTQNI
TECPVKNLTTNGRLGPWSPWQLCEHSDGDSTGSCMCRSRSCDSPRPRCGGRGCEGARIEV
ANCSRNGAWTPWSSWAPCSTSCGIGFQVRQRSCSNPAPRYGGRVCVGQSREERFCNENSP
CPLPIFWSSWGPWNKCSVNCGGGIHSRQRSCENGNTCPGCAVEYKTCNPESCPEVRRNTP
WTPWMPVNITQNGARQEQRFRYTCRAQLSDPHELQFGRKKTESRFCPNDGSAVCDTDSLV
DDLLKTGKTSARIINGGWSFWGAWSSCSRDCELGFRIRKRTCTNPEPKNGGLPCVGSAME
YQDCNPHPCPVKGSWSCWTPWSHCSATCGGGHYQRTRTCTNPAPSSGEDICIGLHTEEAL
CNTHPCEGGWSEWSEWSLCNEEGIQYRSRYCKVHSPDSSQCVGNSTQYQDCLYNEIPVIL
PASSIDESTNCGGFSLIHLIATGVSCFFGSSLLTFVIYVYCQRCQRQSQESTVIHPTTPN
HLHYKGNTTPKNEKYTPMEFKTLNKNNLIPDDRTNFYPLQQTNVYTTTYYPSTLNKYDYR
PEASPGRTFTNS
Download sequence
Identical sequences A0A091FMM1
XP_009568767.1.62272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]