SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091FPV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091FPV7
Domain Number 1 Region: 265-311
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000222
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091FPV7
Sequence length 319
Comment (tr|A0A091FPV7|A0A091FPV7_9AVES) Spondin-2 {ECO:0000313|EMBL:KFO72540.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_09586 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
KVIWTLLVTILGYASSLPVGDDSICAAEDLAKYSIIFTGKWSQTAFPKQYPLYRPPAQWS
SLLGVTHSSDYSMWKKNEYASNGVRDFAEKGEAWVLMKEIEEAGEKIQSVHGIFSAPAIS
SGTGQTSTELEVHPRHPLVSFVVRIVPSPDWFVGIDSLNLCEGDHWVEEVSVDLFPYDAG
TDSGFTFSSPNFATIPQDTVTEITCSSPSHPANSFYYPKLKILPPIAQVTMVKLRKSQLG
LPAPYLNVQAKSNEIIDTVSETPLDCEVSQWSSWGLCRGVCRKTGTKIRTRFVLLQPANN
GMPCPNLDEETGCEPENCV
Download sequence
Identical sequences A0A091FPV7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]