SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091G0A1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091G0A1
Domain Number 1 Region: 1-37
Classification Level Classification E-value
Superfamily Virus ectodomain 0.0000000106
Family Virus ectodomain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091G0A1
Sequence length 60
Comment (tr|A0A091G0A1|A0A091G0A1_9AVES) Uncharacterized protein {ECO:0000313|EMBL:KFO75885.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_05539 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
AIDFLLLAHGHRCEDFEGICCINLSERSWSVHKVISTLLDRTKKLKMDNGFFELENLLNS
Download sequence
Identical sequences A0A091G0A1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]