SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091G0K5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091G0K5
Domain Number 1 Region: 32-128
Classification Level Classification E-value
Superfamily SH2 domain 3.23e-22
Family SH2 domain 0.0003
Further Details:      
 
Domain Number 2 Region: 160-207
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000144
Family SOCS box-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091G0K5
Sequence length 209
Comment (tr|A0A091G0K5|A0A091G0K5_9AVES) Suppressor of cytokine signaling 3 {ECO:0000313|EMBL:KFO74759.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_00407 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNTVRKLQESGFYWSTVTGGEANLLL
STEPAGTFLIRDSSDQRHFFTLSVKTELGTKNLRIQCEGGSFSLQSDPRSSQPVPRFDCV
LKLVHHYMPPAPCAVPEQSGGTIHSKRTYYIYSGGEKIPLVLSRPLSSSVSTLQHLCRKT
VNGHLDSYEKMTQLPAPIKEFLDQYDAPL
Download sequence
Identical sequences A0A091G0K5
XP_009557294.1.62272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]