SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091G175 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091G175
Domain Number 1 Region: 8-44
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000247
Family BAFF receptor-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091G175
Sequence length 160
Comment (tr|A0A091G175|A0A091G175_9AVES) Tumor necrosis factor receptor superfamily member 17 {ECO:0000313|EMBL:KFO75738.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_11876 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
LLTLMAICPKNEYFDNLLLSCKPCHLRCSNTPPPSCENYCNKSEVLWICLGLGVILMLTL
FTFMVLFKWKHLKQLKEKLKNTDSSVELNNILEANTESCVNTEGIRYSPQSETLMYSVEE
CTCSDCGLVKPQRGCETSFPLPATEEGATVLVTTKSFDYC
Download sequence
Identical sequences A0A091G175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]