SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091G289 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091G289
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily Lipocalins 7.17e-35
Family Retinol binding protein-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091G289
Sequence length 159
Comment (tr|A0A091G289|A0A091G289_9AVES) Lipocalin {ECO:0000313|EMBL:KFO76023.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_11248 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
QLTGRWYCVGLASNSHWFKEKKQLMKMCTTTISATEDGNLEVISTYPKLDKCERFNLLFQ
QSGQPGQYKGTSGIAWGSSAAQEKRDLRVVETDYSSYAIVYQVQQSQQEPSTSLQLFMRE
QDASPELLEKFKHLLPTMGLTEDMLAILPKTGECQEGAG
Download sequence
Identical sequences A0A091G289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]