SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091G6T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091G6T9
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily Lipocalins 2.29e-43
Family Fatty acid binding protein-like 0.00000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091G6T9
Sequence length 126
Comment (tr|A0A091G6T9|A0A091G6T9_9AVES) Fatty acid-binding protein, liver {ECO:0000313|EMBL:KFO76839.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_12639 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
MAFNGTWQVYAQENYEEFLKALALPDDLIKVAMDIKPIIEIKQKGDDFIVTSKTPKQSVT
NSFTLGKEAEITTMDGRKLKCTVNMVNGKLVCKAEKFSHEQEIKGSEMVETMTVGGATLV
RRSKRV
Download sequence
Identical sequences A0A091G6T9
XP_009560097.1.62272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]