SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091GEF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091GEF1
Domain Number 1 Region: 124-217
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.57e-33
Family TATA-box binding protein (TBP), C-terminal domain 0.0000029
Further Details:      
 
Domain Number 2 Region: 212-297
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.05e-27
Family TATA-box binding protein (TBP), C-terminal domain 0.00000893
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091GEF1
Sequence length 299
Comment (tr|A0A091GEF1|A0A091GEF1_9AVES) TATA-box-binding protein {ECO:0000313|EMBL:KFO80740.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_03555 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
MDQNNSLPPYAPGLASPQGAMTPGIPIFSPMMPYGTGLTPQPVQSTNSLSILEEQQRQQQ
QQQAAQQSTSQQATQGTSGQTPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASE
SSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSG
KMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTH
QHYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT
Download sequence
Identical sequences A0A091GEF1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]