SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091GI93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091GI93
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily SNARE fusion complex 3.14e-17
Family SNARE fusion complex 0.0000743
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091GI93
Sequence length 55
Comment (tr|A0A091GI93|A0A091GI93_9AVES) Vesicle-associated membrane protein 3 {ECO:0000313|EMBL:KFO82115.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_03128 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
QVVDIMRMNVDKVLERDQKLSELDNRADALQAGASQFETSAAKLKRKYWWKNCKV
Download sequence
Identical sequences A0A087QQL0 A0A087VKQ8 A0A091GI93 A0A091HXJ5 A0A091KY70 A0A091LC56 A0A091MR43 A0A091MVV7 A0A091PIZ3 A0A091Q7M7 A0A091R5C5 A0A091USK3 A0A091XSF6 A0A093CP31 A0A093CWU1 A0A093EYZ2 A0A093FB68 A0A093KTP6 A0A093PKR0 A0A093R333 A0A094LDX2 A0A0A0A8I4 R0JCM4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]