SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091GN23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091GN23
Domain Number 1 Region: 53-122
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000628
Family Growth factor receptor domain 0.0067
Further Details:      
 
Domain Number 2 Region: 117-188
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000492
Family VWC domain 0.062
Further Details:      
 
Domain Number 3 Region: 215-260
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000549
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091GN23
Sequence length 368
Comment (tr|A0A091GN23|A0A091GN23_9AVES) WNT1-inducible-signaling pathway protein 1 {ECO:0000313|EMBL:KFO75517.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_07817 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
MRWLLPWILATSSILQVSLETAGETSANTLGVSAHPTIPAVTEAYTRTQYCKWPCECPKF
PPRCSVGVSLVTDGCDCCKMCAKQRGESCTEADTCDFHRGLYCDYSGDRPRYEIGVCAQI
VGVGCVLNGVRYNNGDTFQPNCKYNCTCINGAVGCVPMCTNSRPPLVWCPNPKLIKMAGK
CCEQWICDDSKKIRKTSPRHISSAAYEGEDEAWQKNCIVHTSSWSPCSKTCGLGISTRIS
NDNDQCRLLKESRLCNMRPCEVDITQHIKPGKKCLAVYRANEPMNYTISGCVSKSPYRPK
YCGICTDNRCCTPYKSKTIEVRFHCPDGTEFSWKIMWINACFCNLNCKNPNDIFADLAHY
HDYSEIAN
Download sequence
Identical sequences A0A091GN23

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]