SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091GND6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091GND6
Domain Number 1 Region: 16-173
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000157
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091GND6
Sequence length 269
Comment (tr|A0A091GND6|A0A091GND6_BUCRH) Tubulin polyglutamylase complex subunit 2 {ECO:0000313|EMBL:KFO85126.1} KW=Complete proteome; Reference proteome OX=175836 OS=Buceros rhinoceros silvestris. GN=N320_03305 OC=Coelurosauria; Aves; Neognathae; Bucerotiformes; Bucerotidae; Buceros.
Sequence
FLETSPGVAEVTIVEKEPAERHAIVSWEQKNSCILPEDLKNFYLMTDGFQLTWSVKTDDA
PMPLGSMVINSVSKLCRLGGSSMYTLPNAPTLADLEDDTDEEGNGDKPEKPHFDSRSLIF
ELDPCNGNGKVCLVYKHAKPVVSPDTEIWFLDRALYWHFLTKTFTAYYRLLITHLGLPQW
QYAFTSYGVSPQAKQWFNMYKPIIINTALLSEEADSFVNKLDPNKVFKSKNKTPVIKKKA
PSQPAGSQKSHTSMTSSKTSSLAGSSSRK
Download sequence
Identical sequences A0A091GND6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]