SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091GNE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091GNE6
Domain Number 1 Region: 248-391
Classification Level Classification E-value
Superfamily L30e-like 1.21e-56
Family ERF1/Dom34 C-terminal domain-like 0.00000024
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 6.28e-50
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.000000625
Further Details:      
 
Domain Number 3 Region: 114-246
Classification Level Classification E-value
Superfamily Translational machinery components 2.14e-49
Family ERF1/Dom34 middle domain-like 0.000000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091GNE6
Sequence length 408
Comment (tr|A0A091GNE6|A0A091GNE6_BUCRH) Eukaryotic peptide chain release factor subunit 1 {ECO:0000313|EMBL:KFO85141.1} KW=Complete proteome; Reference proteome OX=175836 OS=Buceros rhinoceros silvestris. GN=N320_04929 OC=Coelurosauria; Aves; Neognathae; Bucerotiformes; Bucerotidae; Buceros.
Sequence
NGTSMISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKLYNKVP
PNGLVVYCGTIVTEEGKEKKVNIDFEPFKPINTSLYLCDNKFHTEALTALLSDDSKFGFI
VIDGSGALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKVAETA
VQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAIE
LSTEVLSNVKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIM
RYVLHCQGTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATL
EIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY
Download sequence
Identical sequences A0A087QQ93 A0A087V8C0 A0A091G8D9 A0A091GNE6 A0A091IBE8 A0A091IK43 A0A091KT76 A0A091MAW9 A0A091NFI5 A0A091PS64 A0A091Q4I0 A0A091QC22 A0A091S9Z7 A0A091TAW8 A0A091TS34 A0A091UCT0 A0A091WJV8 A0A091WLQ6 A0A093C0I9 A0A093CAN1 A0A093FC01 A0A093FTL1 A0A093GCK5 A0A093H7I6 A0A093IF23 A0A093KV08 A0A093QH09 A0A093RKC4 A0A093SW69 A0A094K6S7 A0A094KIH1 A0A099ZUD8 A0A0A0A5A5 F6PU05 L8IRU7 R0JJK7
ENSVPAP00000005874 9796.ENSECAP00000010949 ENSECAP00000010949 ENSVPAP00000005874 ENSECAP00000010949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]