SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091GQ91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091GQ91
Domain Number 1 Region: 110-373
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.83e-70
Family Protein kinases, catalytic subunit 0.00000138
Further Details:      
 
Domain Number 2 Region: 2-133
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.04e-40
Family Regulator of G-protein signaling, RGS 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091GQ91
Sequence length 375
Comment (tr|A0A091GQ91|A0A091GQ91_BUCRH) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=175836 OS=Buceros rhinoceros silvestris. GN=N320_03719 OC=Coelurosauria; Aves; Neognathae; Bucerotiformes; Bucerotidae; Buceros.
Sequence
LERDYCSICEKQPIGRLLFRQFCETRPELECCIRFLDSVAEYEIAPDEKLGEKGKEVMMK
YLTPESPACVPQVSQDLIRQTEEKLENSPCKELFSLCTKSVLDHLSGEPFQEYLNSMYFD
RFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKRKGE
SMALNEKQILEKVNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEERA
LFYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGESIRGRVGT
VGYMAPEVLNNQRYTLSPDYWGLGCLIYEMIAGQSPFRGRKEKVKREEVDRRVLETEEVY
SHKFSEEAKSICKMV
Download sequence
Identical sequences A0A091GQ91

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]