SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091GQL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091GQL3
Domain Number 1 Region: 522-573
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000889
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 2 Region: 343-399
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000131
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 3 Region: 285-342
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 4 Region: 462-518
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000589
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 5 Region: 403-456
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 6 Region: 233-282
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000379
Family TSP-1 type 1 repeat 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091GQL3
Sequence length 624
Comment (tr|A0A091GQL3|A0A091GQL3_BUCRH) Thrombospondin type-1 domain-containing protein 4 {ECO:0000313|EMBL:KFO85429.1} KW=Complete proteome; Reference proteome OX=175836 OS=Buceros rhinoceros silvestris. GN=N320_05260 OC=Coelurosauria; Aves; Neognathae; Bucerotiformes; Bucerotidae; Buceros.
Sequence
QSIGCDDYLGSDKVIDKCGICGGDNTACKVVSGVFKHTLTNLGYHKIVEIPEGATKINIT
EMSKSNNYLALRSRSGRSIINGNWAIDRPGRYEGGGTMFTYKRPNEISSTAGESFLADGP
TNEVLDVYMIHQQPNPGIHYEYIIPGENVISPQLLAHRRPGEPLNGQLGMPESTAQDDED
FHRETDSLTGQSAGTFPVIQPGRFPSHQPENQVPAVQPPRQNREHNWKQIGKTECTTTCG
KGSQYPVFHCVNRITHEEVSESYCDSSTKPIPEEEACNLFPCPAFWDIGEWSECSKTCGL
GMQHRQILCRQMYANRTLTVQQYRCHHLEKPETTSTCQLKICSEWQIRTEWTSCSVPCGV
GQRTRDVKCVSNLGDVVDDEECNMKLRPNDIENCDMGPCAKSWFLTEWSDRCSAECGDGV
RTRSVVCMTNHVSSLPLEGCGNNRPSETTPCNNGPCAGRVEWFAGGWTQCSTECGSGTQQ
REVICVRKTEGNFDVLNPYECSYLEKPPSQQSCYLKPCGSKWFHTEWSTCSKSCEGGFRV
REVRCLSDDMTASTQCDPQLKPEEKEPCNTQDCIPEIDENCKDKYYNCNVVVQARLCVYT
YYKTACCASCTRVANRQSGFLGRR
Download sequence
Identical sequences A0A091GQL3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]