SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091GS95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091GS95
Domain Number 1 Region: 8-105
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000236
Family Growth factor receptor domain 0.0029
Further Details:      
 
Domain Number 2 Region: 104-156
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000157
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091GS95
Sequence length 167
Comment (tr|A0A091GS95|A0A091GS95_BUCRH) R-spondin-2 {ECO:0000313|EMBL:KFO85295.1} KW=Complete proteome; Reference proteome OX=175836 OS=Buceros rhinoceros silvestris. GN=N320_10342 OC=Coelurosauria; Aves; Neognathae; Bucerotiformes; Bucerotidae; Buceros.
Sequence
ASYGPNPICKGCLSCSKDNGCIRCQHKLFFFLRREGMRQYGYYGLRTPDMNRCSRCRIEN
CDSCFSRDFCTKCKTGFYSHRGRCFRGCPPGFAALEELMECVEGCEVGQWSEWGTCSRNN
KTCGFKWGLETRTRQIVKKPAKDTIPCPTIAESRRCKMAVRHCPGGK
Download sequence
Identical sequences A0A091GS95

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]