SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091GSE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091GSE2
Domain Number 1 Region: 439-495
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000288
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 495-550
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000549
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 552-600
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000209
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 386-436
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 640-692
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 328-374
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000118
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091GSE2
Sequence length 692
Comment (tr|A0A091GSE2|A0A091GSE2_9AVES) Spondin-1 {ECO:0000313|EMBL:KFO77052.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_10747 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
IIDEEETQFMSNCPVAVTESTPRRRTRIQVFWTAPPTGTGCVILKASIVQKRIIYFQDEG
SLTKKICEQDSTSEGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDFPRRTNHWSAII
GGSHSKNYILWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPAWQPL
NVRAAPSAEFSVDRHRHLMSFLTMLGPSPDWNVGLSAEDLCTKDCGWVQKVVQDLIPWDA
GTDSGVTYESPNKPTVPQEKIRPLTSLDHPQSPFYDPEGGSIKLVARVVIERIARKGEQC
NIVPDNIDDIVADLAPEEKEEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLD
LSVPCPDTQDFQPCMGPGCSDEDGSTCMMSDWITWSPCSVSCGMGTRSRERYVKQFPEDG
SMCKVPTEETEKCVVNEDCSPSSCLVTEWGEWDECSASCGMGMKRRHRMIKMTPADGSMC
KAETTEAEKCMMPECHTIPCLLSPWSEWSDCSVTCGKGMRTRQRMLKSAAELGDCNEELE
QAEKCMLPECPIDCELTEWSQWSECNTSCGKGHMIRTRIIKIEPQFGGAACPETVQRTKC
RLRKCLRGPGMEKRRWKEAREKRRSEQAKKNIDSEQYPVCRLKPWTAWTECSTLCGGGIQ
ERYMMVKKRSKSTQFTSCKDKKELRACNVHPC
Download sequence
Identical sequences A0A091GSE2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]