SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091GUN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091GUN6
Domain Number 1 Region: 65-211
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-41
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 393-493
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.01e-31
Family Ras-binding domain, RBD 0.00086
Further Details:      
 
Domain Number 3 Region: 338-407
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000568
Family Ras-binding domain, RBD 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091GUN6
Sequence length 735
Comment (tr|A0A091GUN6|A0A091GUN6_BUCRH) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:KFO86115.1} KW=Complete proteome; Reference proteome OX=175836 OS=Buceros rhinoceros silvestris. GN=N320_00512 OC=Coelurosauria; Aves; Neognathae; Bucerotiformes; Bucerotidae; Buceros.
Sequence
GAKFGHPMGLNQAPLPRSSARRSFGRSKRFSITRSLDDLESATVSDGELNSTDLKDCISE
NSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPVGVKYFSEFLRKEFSEENILFWQ
ACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQAQLADDILNSPHPDMFKEQ
QLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRALPDPQRVPSSPTSKHSVSSEKSNIST
PKKLSGKSKSGRSLNEESGEEDTEKKKRGTFFSWSRSKSLGKSQKRKENGDYPNDSIQSN
GLSYRRESQGSMSSTASLDLSEGSRLPAFVPDKEKSPKYCCINLPDGSSSKMAVRSGFSI
KEVLSGLCEKHGINIAAVDLFLVGGDKPLVLHQDSSILESRDLRLEKRTLFRLDLVPINR
SVGLKAKPTKPVTEVLRPVVAKYGLNLSELVARLNGEQEPLDLGVPISNLDGQRVVLDEK
EPTKGRVFTDKQKGASVKQSATVTTSRNQVSTGEGRALGKSNSIKMKGENGKNAREVRLS
KREDSIAKIGKKKCQKINLDEAEEFFELISKAQSNRADDQRGLLRKEDLILPDFLRLPPT
GPEPSSSTPAGPKGLNKRVSKSDGKDGCTSPSGKQESMQSFNENSVKKMGYSENKHKSAL
TALHSQKTFSVPFNTALSPIPHAQENSATIWKRQSRELQAEAIQMVDDENVADLTLVAEG
DISSPNSTLLPPPPP
Download sequence
Identical sequences A0A091GUN6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]