SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091GXT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091GXT0
Domain Number 1 Region: 36-77
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000000247
Family BAFF receptor-like 0.0018
Further Details:      
 
Domain Number 2 Region: 4-38
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000073
Family BAFF receptor-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091GXT0
Sequence length 281
Comment (tr|A0A091GXT0|A0A091GXT0_9AVES) Tumor necrosis factor receptor superfamily member 13B {ECO:0000313|EMBL:KFO78887.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_00809 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
AKNNCTDQEYWDILVRQCIPCSLLCSQHTVRRCAALCESMNCNSKAGFYYDKLLKECINC
TAICGQHPNQCAPTCEKVLQSCFQILSKQRAQMPLVTPSPHQRVSSTKHLTTLVTASPSI
AVLERKVCVEQDPWLVVYLLLGFCLCTLLCSLLLGWTHLRRKGEVVSCQASAGTCHRKED
SCKANSHRLFADRLVEAGSFGDGSTGSKVPEPVETCGFCFPGHGSAVQETKSCHSTSSHI
VERVAPSHAGICSMGSAGAVPSRDDGHFKIICSPSQEKTPM
Download sequence
Identical sequences A0A091GXT0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]