SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091H1E8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091H1E8
Domain Number 1 Region: 160-205
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000051
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091H1E8
Sequence length 311
Comment (tr|A0A091H1E8|A0A091H1E8_BUCRH) Connective tissue growth factor {ECO:0000313|EMBL:KFO89651.1} KW=Complete proteome; Reference proteome OX=175836 OS=Buceros rhinoceros silvestris. GN=N320_03397 OC=Coelurosauria; Aves; Neognathae; Bucerotiformes; Bucerotidae; Buceros.
Sequence
QACTYPCQCPSQPLQCPAGTSHVCARQLGELCALQKPCDHHKGLYCDFSKIHRGSGICLA
HEGATCDLLGKIYHNGESFQPSCKLQCICMDGAIGCIPLCSEALRLPSPECPNPRRVKFR
NKCCEEWTCEEGSEENRFEMAMAVFREDPAQKPELNNLQENCLVQTTEWSACSKSCGMGI
SARVTNDNPQCRLEKETRLCMVRPCDFSVEKAKKGKKCIRTPKPRQSLHFEFSGCTSTRS
YRPRFCGSCTDGRCCTPYATSTMEVEFRCPEGDFFQRKMMFIKMCSCHYDCPRDNDIFLA
TYHRRMIGDHI
Download sequence
Identical sequences A0A091H1E8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]