SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091H587 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091H587
Domain Number 1 Region: 785-866
Classification Level Classification E-value
Superfamily DEATH domain 5.12e-20
Family DEATH domain, DD 0.00011
Further Details:      
 
Domain Number 2 Region: 129-220
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000014
Family I set domains 0.039
Further Details:      
 
Domain Number 3 Region: 219-270
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000693
Family TSP-1 type 1 repeat 0.00047
Further Details:      
 
Domain Number 4 Region: 273-327
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000746
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 5 Region: 22-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000442
Family I set domains 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091H587
Sequence length 875
Comment (tr|A0A091H587|A0A091H587_9AVES) Netrin receptor UNC5A {ECO:0000313|EMBL:KFO81467.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_03097 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
TGAQQSATVANPVSGASPDLLPHFQLEPEDVYIVKNKAVSLACRATPATQIYFKCNGEWV
HQGDHVTQHSTDHSTGLPVMEVRIEVTRQQVEKIFGLEEYWCQCVAWSSSGTTKSQKAFV
RIAYLRKNFEQEPTAREVSIEQGIVLPCRPPEGIPPAEVEWLRNEELVDPALDTNVYVTP
EHSLVLRQARLADTANYTCVAKNIVARRRSASAAVIVYVNGGWSTWTQWSGCSTSCGRGW
QKRSRTCTNPTPLNGGAFCEGQNVQKTACTTLCPVDGAWSEWSKWSVCGAECTHWRSREC
SEPTPRNGGRECHGPELDTRNCTSELCSHVVPGTEDVALYVGLVAVAVCLVLLLLVGVLL
YCRKKGGLDADVADSSILTAGFQPVSIKPSKADNPSLLTIQPDLSTTTMTYQGSLCPRQD
GPAKLQLPNGHLLSPLGAGRHTLHHSSPAAEGADFVARLSTQSYFRSLPRGTTNMAYGTF
NFLGGRLMIPNTGISLLIPPDAIPRGKIYEVYLTLHKQEEVRLPLSGCQTLLSPIVSCGP
PGVLLTRPAILAMGHCVEASAENWSIWLKKQSCEGTWEDVLQLGAEPCTELYYCQLEAQA
CYIFTEQLGRFALVGESLSMAASKRLKLVLFAPSACPSLEYNIRVYCLSDTQDVLKEVIQ
LEKQLGGQLIGAPRVLHFKDSYHNLRLSIHDMPSSLWKSKLLASYQEIPFYHIWSGLQPF
LHCTFTLERLSPSTCELACKIWVWQVEGDGQSFTVNFNIAKDTRFSDWLVPDSEVGAPAL
VGPSAFKIPFLIRQKIISSLDPPGTRGADWRMLAQKLNLDSHLSFFASKSSPTAMILNLW
EARHFPNGNLSQLAAAVAEVGKQDGALFAVSEAEC
Download sequence
Identical sequences A0A091H587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]