SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091HA16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091HA16
Domain Number 1 Region: 600-678
Classification Level Classification E-value
Superfamily DEATH domain 3.18e-19
Family DEATH domain, DD 0.0000595
Further Details:      
 
Domain Number 2 Region: 1-51
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000471
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 
Domain Number 3 Region: 57-104
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000536
Family TSP-1 type 1 repeat 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091HA16
Sequence length 703
Comment (tr|A0A091HA16|A0A091HA16_BUCRH) Netrin receptor UNC5D {ECO:0000313|EMBL:KFO84283.1} KW=Complete proteome; Reference proteome OX=175836 OS=Buceros rhinoceros silvestris. GN=N320_03068 OC=Coelurosauria; Aves; Neognathae; Bucerotiformes; Bucerotidae; Buceros.
Sequence
VNGGWSSWTEWSNCNARCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCTALCPVDGN
WEVWSEWSVCSPECEHLRVRECVAPPPRNGGKYCEGLSQESENCTDGLCIQDKKPLHEIK
SQNIETASDIALYSGLGAAVIAVAVLVVGVTLYRRSQSEYGVDVIDSSALTGGFQTFNFK
TVRQGNSLLLNSSMQPDLTVSRTYSGPICLQDPMDKELMTESSLFNPLSDIKVKVQSSFM
VSLGVTERAEYHGKAHSGTFPHGNNRAFGTIQARNKATYIQNLSSISTTSELKTSAIFGH
LGGRLVVPNTGVSLLIPHGAIPEESSWEIYLAITQKESSLQLEGSDVLLGPEVTCGPSDL
SVSTPIALTIPHCAEVNSELWNIHLKKRTEQGKWEEVMSVEEETTSCYCLLDPYACHILL
NSFGTYALIGEPISDCAVRQLKVAVFGCLSCNSLDYNLRVYCMDNTPCAFQEVVLDERLQ
GGQLLEEPKLLHFRGNTFSLQISVLDIPPFLWRIKPFTACQEIPFSRVWCSSQKPLHCAF
SLERYTPATTQLSCKVCVRQVKGHEQILQIQTSILENERETITFFAQDDSNFPAQMGPKA
FKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSITRNLSYFATQSSPSAVILDLWEARHQ
HDGDLDSLACALEEIGRTHSKISDVTETEIEEPDFNYSRQNGL
Download sequence
Identical sequences A0A091HA16

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]