SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091HCU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091HCU1
Domain Number 1 Region: 175-320
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.89e-24
Family Regulator of G-protein signaling, RGS 0.003
Further Details:      
 
Domain Number 2 Region: 410-538
Classification Level Classification E-value
Superfamily PX domain 1.44e-21
Family PX domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091HCU1
Sequence length 793
Comment (tr|A0A091HCU1|A0A091HCU1_BUCRH) Sorting nexin-14 {ECO:0000313|EMBL:KFO93289.1} KW=Complete proteome; Reference proteome OX=175836 OS=Buceros rhinoceros silvestris. GN=N320_11059 OC=Coelurosauria; Aves; Neognathae; Bucerotiformes; Bucerotidae; Buceros.
Sequence
RNITDDESSVDELRGTLRFFASVLVRRIHKVDIPTVVTKKMLKAAMKHIEVIAKARQKVK
NAEFLQQAALEEYGPELHVALRSRRDELHYLRKLTELLFPYILPPKSTECRSLALLIREI
LPGSVFLPSMDFLADPDTVNHLLLIFIDDSPPEKATEPMSSLVPFLQKFAEPRNKKPSVL
KLELKEIRDQQDLLFRFMNFLKQEGAVHVLQFCLTVEEFNDRILRPELSDTEKMSLHEEV
QKIYKTYCLDESIDKIRFDPFIVEEIQRIAEGPYMDVVKLQTMRCLFEAYEHVLSLLENV
FTPMFCHSDEYFRHLLRGAESPTRNSKFNRSSLSLDDFRTTQKRGESFGISRIGNKIKGV
FKSSAMEGAMLPNYNLNEGEDDFIEEGVMVMEDDSPEEAVSTPNTPRNLAAWKISIPYVD
FFDDPSLERKDRKERIPVFCIDVERNDRRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGT
FPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLLQHPELSNSQLLADFLSPNGGETQFL
DKMLPDVNLGKIIKSVPGKLMKEKGQHLEPFIMNFINSCESPKPKPSRPELTILSPTSEN
NKKLFNDLFKNNANRSENTERRQNQNYFMEVMTVEGVYDYLMYVGRVVFHIPDWLHHLLM
GGRILFKNTLELYTDYYLHCKLEQLFQEHRLVSLITLLRDAVFCENTEPRSPQDKQKRAK
QTFEEMMRYIPDLIGKCIGEEAKYEGIRLLFDGMQQPVLNKQLTYVLLDIGIQELFPELS
KGPKEASSVSCWM
Download sequence
Identical sequences A0A091HCU1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]