SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091HDT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091HDT4
Domain Number 1 Region: 1290-1361
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 902-975
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000172
Family I set domains 0.039
Further Details:      
 
Domain Number 3 Region: 1190-1265
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000313
Family I set domains 0.047
Further Details:      
 
Domain Number 4 Region: 792-858
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 397-457
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000405
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 682-737
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000575
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 7 Region: 739-797
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 8 Region: 549-603
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000209
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 9 Region: 452-512
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000366
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 10 Region: 53-101
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000314
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 11 Region: 319-379
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000615
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 12 Region: 626-681
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000157
Family TSP-1 type 1 repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091HDT4
Sequence length 1366
Comment (tr|A0A091HDT4|A0A091HDT4_BUCRH) ADAMTS-like 3 {ECO:0000313|EMBL:KFO92972.1} KW=Complete proteome; Reference proteome OX=175836 OS=Buceros rhinoceros silvestris. GN=N320_02790 OC=Coelurosauria; Aves; Neognathae; Bucerotiformes; Bucerotidae; Buceros.
Sequence
QTRAEQSQGAYFLPEFALSPQGSFLEDTTGEQFLTYRYDDQTSRITRSDEDKEGSWDAWG
AWSDCSRTCGGGASYSLRRCLNGRNCEGRNIRYKTCSSNDCPSDVGDFRAQQCSAYNDVK
YQGHFYEWIPVYNDPTAPCALKCQALGKNLIVELAPKVLDGTRCNVESLDMCISGICQAV
GCDRQLGSNAKEDNCGICAGDGSTCRLVRGQAKAHVSPEKREETVIAVPHGSRSVRITLK
GPAHLVIESKTLQGDKGEHSFNAPGTFVIENTTVEFQRSTDREIIKIQGPLGADFIIKTR
YSGSKESVVQFFFYQPISHQWRQTEFFPCTVTCGGGYQLNSAECVDIRLKRVVPDHYCHY
YPENKKPKPKLKECNMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGGGIQRRS
FVCVEETIHGEILQVEEWKCMYAPKPKVIQTCNLFDCPKWVAMEWSQCTVTCGRGLRYRV
VLCIDHRGQHVGGCNPQLKLHIKEECIVPIPCYKPKEKSPVEAKLPWFKQAHEMEETRTV
SEEPTFIPEPWSPCSATCGNGIQVREVKCRILLAFTQTEVELPEEECEEVKPPTERVCHQ
ASCDSDTVPFTPEFSRAEDGSVIYDWEYIGFTPCSATCLGGTQEAIAMCLHVETKQAVNE
TLCDNSKRPPPMTRTCNRKLCPPRWQSGPWRRCSATCGVGIQSRDVYCQQPGGSAVAAEE
CKDKKPHSLQACNQIDCPPVWHVEEWQQCSHTCGGGIQTRKVYCKQLLTDGSFLKHSDDT
CREPKLPTSKPCAKVDCPPQLVFGEWSECSVSCGVGIQRRKVACQNLTAKGQYVTLNGSM
CSGLSPSLLVRSCQMNACNKIKPKLPGKYSAHGPQIVSIHRVYIQTRQEKRINFTIGSRA
YLLPKTSVVIKCPVRRFQKSLIRWEKDGQHLQNSKRLGITKSGSLKIHSLEATDIGVYRC
IAGSVHETFVLKLIGTDNRLIEPPNLRKHASETSNTDHNEANSFEAKWHKMSKMWQIWSK
KNELYLGDRQINDQPFLRNLETFGSNSAEDFSSHEFKNKRLEAAVLQGAYSMDTAQFEEL
IRNMSQLIETGEVNDDLASQLIYQLVAELSSPPQSTTEKWKGAQDEKRVSKLTGKSPNES
EHFSTKTVDKLMFDQKVPVIMRQKEIPQVSFNKTVTVRIGNTIFLTKNTHVVNLLCETAG
ISEVKYTWTKDGKTLKASEKVILDTIGKVRIQNPTQKELGTYGCLVVNDFGFDTETSLLL
RAEIPVILSSVLNVTNLEASSLSAVVGGTVGARIGANITVACPVKGVPQPNVTWFKKEDI
LQTNSFLVLNGSLFLRNVSHEDAGIYTCRATNALGKAEAASVVHLS
Download sequence
Identical sequences A0A091HDT4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]