SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091HFZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091HFZ6
Domain Number 1 Region: 11-213
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.17e-48
Family Reprolysin-like 0.002
Further Details:      
 
Domain Number 2 Region: 305-360
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000183
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 3 Region: 600-659
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091HFZ6
Sequence length 677
Comment (tr|A0A091HFZ6|A0A091HFZ6_BUCRH) A disintegrin and metalloproteinase with thrombospondin motifs 3 {ECO:0000313|EMBL:KFO86308.1} KW=Complete proteome; Reference proteome OX=175836 OS=Buceros rhinoceros silvestris. GN=N320_12386 OC=Coelurosauria; Aves; Neognathae; Bucerotiformes; Bucerotidae; Buceros.
Sequence
RRRRHAGDDDYNIEVLLGVDDSVVRFHGKEHVQNYLLTLMNIVNEIYHDESLGVHINVVL
VRMIMLGYAKSISLIERGNPSRSLENVCRWAYQQQKSDPSHSEHHDHAIFLTRQDFGPAG
MQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDETAMGSVM
APLVQAAFHRYHWSRCSGQELKRYIHSYDCLLDDPFEHDWPKLPELPGINYSMDEQCRFD
FGVGYKMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCYKGHCMWKNV
NQLKQDGNWGPWTKFGSCSRTCGTGVRFRTRQCNNPMPINGGEDCAGVNFEFQLCNTEEC
PKHFEDFRAQQCQQRNSHFEYQHSKHHWLPYEHPDANKRCHLYCQSKETGDVASMKQLAH
DGTRCSYKDAYSICVRGECVKVGCDREIGSNKVDDKCGVCGGDNSHCRTVKGTFTRTPKK
LGYLKMFDIPPGARHVFIQEDEASPHFLAIKNQATGHYILNGKGEEARPRSFIDLGVEWE
YNIEDDIETLHTDGPLHDAVVVLIIPRENDTRASLTYKYIIHEDSVPTINSNNVLQEEVD
TFEWALKSWSQCSKPCGGGFQYTKYGCRRKSDNKMVHRSFCEGSKKPKPIRRMCNLHECS
QPLWAAEEWEHCTKTCG
Download sequence
Identical sequences A0A091HFZ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]